Research Use Only · 19+
Vitality

Confirm Your
Access

All products are sold strictly for in vitro laboratory research — not for human or animal consumption. No dosing guidance is provided.

You must be 19 years of age or older and acting in a qualified research capacity to access this site.

By entering you confirm you meet the age of majority and that all purchases are for legitimate research use only.

Third-Party Tested · COA Available · cGMP Labs
I do not qualify · Exit
Free Xpresspost shipping on orders $300+ · New batch: BPC-157 + TB-500 now in stock · COA included with every order · ISO 9001:2015 certified lab · Cold-chain shipping nationwide ·
Research Compound
Awaiting product image

LL-37

$75.00

Cathelicidin-derived antimicrobial peptide.

≥99% HPLC4493.33 g/molLyophilized powder
SKU: VT-LL37 Category:
Identity

Compound Specifications

Sequence
[LL-37, 37 aa]
Molecular Formula
C205H340N60O53
Molecular Weight
4493.33 g/mol
CAS Number
154947-66-7
Purity (HPLC)
≥99%
Physical Form
Lyophilized powder
Storage
Store at -20°C, protected from light

Research Background

LL-37 is the only human member of the cathelicidin family of antimicrobial peptides. It is studied for its role in innate immune signaling, modulation of inflammatory response, and in vitro wound-healing models.

For in vitro laboratory research only. Not for human or animal consumption. No dosing guidance provided.

Certificate of Analysis

A batch-specific COA ships in the box with every order and is matched to your vial's lot number.

Third-Party Tested Independent lab, every batch
HPLC + Mass Spec Purity & identity confirmed
ISO 9001:2015 Certified manufacturing
Cold-Chain Ship Temperature-controlled

Description

Cathelicidin-derived antimicrobial peptide.

Reviews

There are no reviews yet.

Be the first to review “LL-37”

Your email address will not be published. Required fields are marked *

Related products

New Release Alerts

First access to new compounds and COA drops

Research professionals only. Unsubscribe anytime.